PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G027300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 271aa    MW: 30283.3 Da    PI: 4.7328
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G027300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEd+ l+  ++ +G g+W++ ++  g+ R++k+c++rw +yl
  Aqcoe5G027300.1.p 14 RGPWTPEEDQVLIAFIQNYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                       89******************************99************97 PP

2Myb_DNA-binding51.81.9e-1667112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg+++ eE+e +++++++lG++ W++Ia +++ gRt++++k+ w+++l
  Aqcoe5G027300.1.p  67 RGNFSNEEEETIIKLHEMLGNR-WSAIAGRLP-GRTDNEIKNVWHTHL 112
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.039961IPR017930Myb domain
SuperFamilySSF466897.49E-3110108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-151461IPR001005SANT/Myb domain
CDDcd001674.06E-111661No hitNo description
PROSITE profilePS5129425.07562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2665117IPR009057Homeodomain-like
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002494.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.06E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDQVLIAFIQ NYGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SNEEEETIIK LHEMLGNRWS AIAGRLPGRT DNEIKNVWHT HLKKRLKKNQ  120
TTPEKKQNST ETSKCETSNS SLSEPAINSQ PQSITENSSS YDSVSPQQSS SEFSSGADSS  180
SVISVDNHDM GTMGEYNESS DNFFDIDESF WTDALAVENF NMPGDFSPSA SNETQVQSSI  240
SSNSSNNDDG MDFWFDLFIQ AGMQPVLPEF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262320.11e-107PREDICTED: myb-related protein Myb4
SwissprotQ7XBH46e-83MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLQ9SLT11e-104Q9SLT1_TOBAC; Myb-related transcription factor LBM2
STRINGPOPTR_0005s24550.11e-101(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.15e-83myb domain protein 15